Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADP-ribosylation factor 1 (ARF1)

This Recombinant Human ADP-ribosylation factor 1 (ARF1) spans the amino acid sequence from region 2-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P84077

Expression Region

2-181aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVPR1A Rabbit Polyclonal Antibody
HA500002 100 µL

AVPR1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cy5® goat anti-rabbit IgG (H+L)
16871-AAT 1 mg

Cy5® goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
FAM210A (NM_001098801) Human Over-expression Lysate
LC420337 20 µg

FAM210A (NM_001098801) Human Over-expression Lysate

Sign In for Pricing
View Details
GALNT1 (NM_020474) Human Recombinant Protein
TP314166L 1 mg

GALNT1 (NM_020474) Human Recombinant Protein

Sign In for Pricing
View Details
Human C2CD4A activation kit by CRISPRa
GA115530 1 Kit

Human C2CD4A activation kit by CRISPRa

Sign In for Pricing
View Details
CEP290 Antibody
KC-1210-01 50 μL

CEP290 Antibody

Sign In for Pricing
View Details