Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interferon tau-1 (IFNT1)

This Recombinant Sheep Interferon tau-1 (IFNT1) spans the amino acid sequence from region 24-195aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-tau-1) (Antiluteolysin) (Trophoblast antiluteolytic protein) (Trophoblast protein 1) (TP-1) (Trophoblastin)

UniProt

P56828

Expression Region

24-195aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Neuroscience; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L1CAM Human Recombinant Protein
TP721330 25 µg

L1CAM Human Recombinant Protein

Sign In for Pricing
View Details
Pign Mouse Gene Knockout Kit (CRISPR)
KN513273 1 Kit

Pign Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein
TP307428M 100 µg

Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

Sign In for Pricing
View Details
LY75 Antibody
KC-7469-01 50 μL

LY75 Antibody

Sign In for Pricing
View Details
LY75 Antibody
KC-7469-02 100 µL

LY75 Antibody

Sign In for Pricing
View Details
LY75 Antibody
KC-7469-03 1 mL

LY75 Antibody

Sign In for Pricing
View Details