Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cellular tumor antigen p53 (TP53) (Y220C)

This Recombinant Human Cellular tumor antigen p53 (TP53) (Y220C) spans the amino acid sequence from region 1-393aa (Y220C) . Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)

UniProt

P04637

Expression Region

1-393aa (Y220C)

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin2 Protein Vector (Rat) (pPM-C-HA)
21437026 500 ng

Gemin2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Atto 488 200 nmol scale
26-6955-02 1 Each

Atto 488 200 nmol scale

Sign In for Pricing
View Details
H-Phe-Phe-OMe·HCl
5-03245 5 g

H-Phe-Phe-OMe·HCl

Sign In for Pricing
View Details
Recombinant Human Creatine Kinase, Mitochondrial 1A (CKMT1A)
RPU52979-01 50 µg

Recombinant Human Creatine Kinase, Mitochondrial 1A (CKMT1A)

Sign In for Pricing
View Details
Recombinant Human Creatine Kinase, Mitochondrial 1A (CKMT1A)
RPU52979-02 100 µg

Recombinant Human Creatine Kinase, Mitochondrial 1A (CKMT1A)

Sign In for Pricing
View Details
Recombinant Human Creatine Kinase, Mitochondrial 1A (CKMT1A)
RPU52979-03 1 mg

Recombinant Human Creatine Kinase, Mitochondrial 1A (CKMT1A)

Sign In for Pricing
View Details