Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae DNA-binding protein RAP1 (RAP1), partial

This Recombinant Saccharomyces cerevisiae DNA-binding protein RAP1 (RAP1), partial spans the amino acid sequence from region 353-598aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Repressor/activator site-binding protein) (SBF-E) (TUF)

UniProt

P11938

Expression Region

353-598aa

Tag

Tag-Free

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPIND1 Antibody
E312830 200 µL

SERPIND1 Antibody

Sign In for Pricing
View Details
Aluminium‚ 2,4-pentanedionate, 97+%
GX5194-250g 250 g

Aluminium‚ 2,4-pentanedionate, 97+%

Sign In for Pricing
View Details
CEP120 Rabbit Polyclonal Antibody (BF680)
orb2520677 100 µL

CEP120 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
MPHOSPH6
CSB-CL014751HU1 10 μg Plasmid + 200 μL Glycerol

MPHOSPH6

Sign In for Pricing
View Details
Dystonin (DST) (NM_001723) Human Tagged ORF Clone
RG214007 10 µg

Dystonin (DST) (NM_001723) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Slc5a8 Pre-designed siRNA Set B
SI113280B 1 Each

Mouse Slc5a8 Pre-designed siRNA Set B

Sign In for Pricing
View Details