Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial

This Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial spans the amino acid sequence from region 165-370aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Multiple EGF-like domains protein 6) (Epidermal growth factor-like protein 3) (EGF-like protein 3)

UniProt

O75095

Expression Region

165-370aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYELDTDQRTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETMAR (NM_006515) Human Tagged Lenti ORF Clone
RC229337L2 10 µg

SETMAR (NM_006515) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
XYLT2 Protein Vector (Mouse) (pPB-N-His)
PV247943 500 ng

XYLT2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
UFL1 (NM_015323) Human Over-expression Lysate
LS023376-100ug 100 µg

UFL1 (NM_015323) Human Over-expression Lysate

Sign In for Pricing
View Details
H1oo (H1FOO) Rabbit Polyclonal Antibody
AP55001SU-N 200 µL

H1oo (H1FOO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Tryptophan 2,3-dioxygenase (TDO2) ELISA Kit
MBS283965-01 48 Tests

Mouse Tryptophan 2,3-dioxygenase (TDO2) ELISA Kit

Sign In for Pricing
View Details
Mouse Tryptophan 2,3-dioxygenase (TDO2) ELISA Kit
MBS283965-02 96 Tests

Mouse Tryptophan 2,3-dioxygenase (TDO2) ELISA Kit

Sign In for Pricing
View Details