Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2), partial
This Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2), partial spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(3-methylbutanal reductase) (Genes de respuesta a estres protein 2) (Isovaleraldehyde reductase)
UniProt
Q12068
Expression Region
1-120aa
Tag
N-terminal 6xHis-KSI-tagged
Source
E.coli
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
172068-01 20 µg
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II)
Sign In for Pricing
View Details 172068-02 100 µg
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II)
Sign In for Pricing
View Details 
HP231453 200 Reactions
BTBD11 Human qPCR Primer Pair (NM_001018072)
Sign In for Pricing
View Details TL701685V 500 µL Each
Mynn Rat shRNA Lentiviral Particle (Locus ID 361924)
Sign In for Pricing
View Details 