Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kelch domain-containing protein 3 (KLHDC3)

This Recombinant Human Kelch domain-containing protein 3 (KLHDC3) spans the amino acid sequence from region 1-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Testis intracellular mediator protein)

UniProt

Q9BQ90

Expression Region

1-382aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YTHD2, CT (YTHDF2, HGRG8, YTH domain family protein 2, CLL-associated antigen KW-14, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2)
MBS6006621-01 0.2 mL

YTHD2, CT (YTHDF2, HGRG8, YTH domain family protein 2, CLL-associated antigen KW-14, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2)

Sign In for Pricing
View Details
YTHD2, CT (YTHDF2, HGRG8, YTH domain family protein 2, CLL-associated antigen KW-14, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2)
MBS6006621-02 5x 0.2 mL

YTHD2, CT (YTHDF2, HGRG8, YTH domain family protein 2, CLL-associated antigen KW-14, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2)

Sign In for Pricing
View Details
Cresyl Violet acetate 100mg
A19771-100 100 mg

Cresyl Violet acetate 100mg

Sign In for Pricing
View Details
HEPACAM2 Protein, Rat, Recombinant (His Tag)
MBS8123395-01 0.1 mg

HEPACAM2 Protein, Rat, Recombinant (His Tag)

Sign In for Pricing
View Details
HEPACAM2 Protein, Rat, Recombinant (His Tag)
MBS8123395-02 5x 0.1 mg

HEPACAM2 Protein, Rat, Recombinant (His Tag)

Sign In for Pricing
View Details
Pigeon Dihydrofolate Reductase (DHFR) ELISA Kit
MBS9346465 Inquire

Pigeon Dihydrofolate Reductase (DHFR) ELISA Kit

Sign In for Pricing
View Details