Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-G-associated kinase (GAK), partial, Biotinylated

This Recombinant Human Cyclin-G-associated kinase (GAK), partial, Biotinylated spans the amino acid sequence from region 40-314aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O14976

Expression Region

40-314aa

Tag

N-terminal GST-tagged and C-terminal Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Splicing factor 3A subunit 3 (SF3A3) ELISA Kit
EIA06863Gu 1 Kit

Guinea pig Splicing factor 3A subunit 3 (SF3A3) ELISA Kit

Sign In for Pricing
View Details
Nacc1 Mouse Pre-designed siRNA Set A
HY-RS21662 1 Set

Nacc1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Hspb8 siRNA Oligos set (Mouse)
24022174 3x 5 nmol

Hspb8 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
B4GALT7 (NM_007255) Human Over-expression Lysate
LS011285-20ug 20 µg

B4GALT7 (NM_007255) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Complement C1q tumor necrosis factor related protein 1 (C1QTNF1/CTRP1) ELISA Kit
GTR10327705 96 Well

Human Complement C1q tumor necrosis factor related protein 1 (C1QTNF1/CTRP1) ELISA Kit

Sign In for Pricing
View Details
Clrn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
16381116 3x 1.0 µg

Clrn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details