Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Artemisia vulgaris Non-specific lipid-transfer protein

This Recombinant Artemisia vulgaris Non-specific lipid-transfer protein spans the amino acid sequence from region 1-37aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LTP) (Pollen allergen Art v 3) (allergen Art v 3)

UniProt

P0C088

Expression Region

1-37aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Artemisia vulgaris (Mugwort)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYOU1 3'UTR Lenti-reporter-Luc Vector
24122081 1.0 µg

HYOU1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
JAB1 (COPS5) (NM_006837) Human Recombinant Protein
TP300979M 100 µg

JAB1 (COPS5) (NM_006837) Human Recombinant Protein

Sign In for Pricing
View Details
CHST9 Protein Lysate
OCOA07781-20UG 20 µg

CHST9 Protein Lysate

Sign In for Pricing
View Details
TMPRSS2 (IN) Peptide
MBS154950-01 0.05 mg

TMPRSS2 (IN) Peptide

Sign In for Pricing
View Details
TMPRSS2 (IN) Peptide
MBS154950-02 5x 0.05 mg

TMPRSS2 (IN) Peptide

Sign In for Pricing
View Details
APOL1 Recombinant Antibody
bsm-61963R-01 20 µL

APOL1 Recombinant Antibody

Sign In for Pricing
View Details