Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dickkopf-related protein 4 (DKK4)

This Recombinant Human Dickkopf-related protein 4 (DKK4) spans the amino acid sequence from region 19-224aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Dickkopf-4) (Dkk-4) (hDkk-4)

UniProt

Q9UBT3

Expression Region

19-224aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD82 Mouse Monoclonal Antibody [Clone ID: C33]
AM26701PU-N 100 µg

CD82 Mouse Monoclonal Antibody [Clone ID: C33]

Sign In for Pricing
View Details
2-Toluidine-13C6
TRC-T536208-1MG 1 mg

2-Toluidine-13C6

Sign In for Pricing
View Details
Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit
E-MSEL-M0094-01 24 Tests

Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit
E-MSEL-M0094-02 48 Tests

Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit
E-MSEL-M0094-03 96 Tests

Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit

Sign In for Pricing
View Details
LIFR Antibody
KC-1915-01 50 μL

LIFR Antibody

Sign In for Pricing
View Details