Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2)

This Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) spans the amino acid sequence from region 1-419aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Basic leucine zipper and W2 domain-containing protein 2)

UniProt

Q9Y6E2

Expression Region

1-419aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BORIS (CTCFL) Rabbit Polyclonal Antibody
TA375187 100 µL

BORIS (CTCFL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-E-cadherin (Tyr754) Peptide
AF7218-BP 1 mg

Phospho-E-cadherin (Tyr754) Peptide

Sign In for Pricing
View Details
Recombinant Human INHBA protein, N-His Tag
MBS1562911-01 0.05 mg

Recombinant Human INHBA protein, N-His Tag

Sign In for Pricing
View Details
Recombinant Human INHBA protein, N-His Tag
MBS1562911-02 0.1 mg

Recombinant Human INHBA protein, N-His Tag

Sign In for Pricing
View Details
Recombinant Human INHBA protein, N-His Tag
MBS1562911-03 5x 0.1 mg

Recombinant Human INHBA protein, N-His Tag

Sign In for Pricing
View Details
2 x Real Time PCR Mix(Probe,ROX)
4303A 1 mL

2 x Real Time PCR Mix(Probe,ROX)

Sign In for Pricing
View Details