Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3)

This Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3) spans the amino acid sequence from region 26-310aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DNase gamma) (DNase I homolog protein DHP2) (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD)

UniProt

O55070

Expression Region

26-310aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAN Binding Protein 10 (RANBP10) Antibody
abx237101 100 µg

RAN Binding Protein 10 (RANBP10) Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-NUP133 Plasmid
PVT14143 2 µg

pCMV-SPORT6-NUP133 Plasmid

Sign In for Pricing
View Details
C18ORF54 antibody
70R-1959 100 µL

C18ORF54 antibody

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RIIA/CD32a Antibody (FCGR2A/479) [DyLight 405]
NBP3-08220V 100 µL

Mouse Monoclonal Fc gamma RIIA/CD32a Antibody (FCGR2A/479) [DyLight 405]

Sign In for Pricing
View Details
Encephalopsin (OPN3) Human Over-expression Lysate
orb1368275 20 µg

Encephalopsin (OPN3) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human CHRDL1 Antibody (SAA1791)
RHJ49801 100 μg

Anti-Human CHRDL1 Antibody (SAA1791)

Sign In for Pricing
View Details