Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Camelpox virus CMP178R (CMP178R), partial

This Recombinant Camelpox virus CMP178R (CMP178R), partial spans the amino acid sequence from region 20-275aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q775M3

Expression Region

20-275aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Camelpox virus (strain CMS)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYYSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNATITLICKDETKYFRCEEKNENTSWNDTVTCPNAECQSLQLEHGSCQPVKEKYSFGEHITINCDVGYEVIGASYISCTANSWNIIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSSSSTCIDGKWNPVLPICVRSNEEFDPVEDGPDDETDLSKLSKDVVQYEQEIESLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human IARS2 shRNA (UAS) - Lentiviral human IARS2 shRNA (UAS, iRFP) (25)
GTR15340253 1 Vial

Lentiviral human IARS2 shRNA (UAS) - Lentiviral human IARS2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
HDAC11, NT (Histone Deacetylase 11, HD11) (MaxLight 490)
MBS6479614-01 0.1 mL

HDAC11, NT (Histone Deacetylase 11, HD11) (MaxLight 490)

Sign In for Pricing
View Details
HDAC11, NT (Histone Deacetylase 11, HD11) (MaxLight 490)
MBS6479614-02 5x 0.1 mL

HDAC11, NT (Histone Deacetylase 11, HD11) (MaxLight 490)

Sign In for Pricing
View Details
ViPrimePLUS Encephalitozoon cuniculi qPCR Test Kit
VICE003 1 Kit

ViPrimePLUS Encephalitozoon cuniculi qPCR Test Kit

Sign In for Pricing
View Details
Cullin 3 (CUL-3) (AP)
MBS6470854-01 0.1 mL

Cullin 3 (CUL-3) (AP)

Sign In for Pricing
View Details
Cullin 3 (CUL-3) (AP)
MBS6470854-02 5x 0.1 mL

Cullin 3 (CUL-3) (AP)

Sign In for Pricing
View Details