Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cowpox virus Protein OPG161, partial

This Recombinant Cowpox virus Protein OPG161, partial spans the amino acid sequence from region 58-185aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G0XSP8

Expression Region

58-185aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Cowpox virus (CPV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PP1C beta Monoclonal Antibody
E-AB-81598-01 50 µL

Recombinant PP1C beta Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PP1C beta Monoclonal Antibody
E-AB-81598-02 100 µL

Recombinant PP1C beta Monoclonal Antibody

Sign In for Pricing
View Details
GI24 (C10orf54) (NM_022153) Human Recombinant Protein
TP700218 20 µg

GI24 (C10orf54) (NM_022153) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS711569 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5b) ELISA Kit
E-EL-M3100-01 24 Tests

Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5b) ELISA Kit

Sign In for Pricing
View Details
Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5b) ELISA Kit
E-EL-M3100-02 48 Tests

Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5b) ELISA Kit

Sign In for Pricing
View Details