Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Protein OPG161 (OPG161), partial

This Recombinant Variola virus Protein OPG161 (OPG161), partial spans the amino acid sequence from region 57-184aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P0DON1

Expression Region

57-184aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRLNQCMSANEAAITDATAVAAALSTHRKVASSTTQYKHQESCNGLYYQGSCYIFHSDYQLFSDAKANCATESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTTDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Phogrin Antibody
MBS4506366-01 0.05 mL

Rabbit anti-Phogrin Antibody

Sign In for Pricing
View Details
Rabbit anti-Phogrin Antibody
MBS4506366-02 0.1 mL

Rabbit anti-Phogrin Antibody

Sign In for Pricing
View Details
Rabbit anti-Phogrin Antibody
MBS4506366-03 5x 0.1 mL

Rabbit anti-Phogrin Antibody

Sign In for Pricing
View Details
TSC22D1 Mouse Monoclonal Antibody [Clone ID: LBI3B10]
AMM12889V 100 µL

TSC22D1 Mouse Monoclonal Antibody [Clone ID: LBI3B10]

Sign In for Pricing
View Details
VPS37A (NM_152415) Human Tagged Lenti ORF Clone
RC209716L4 10 µg

VPS37A (NM_152415) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gm16430 3'UTR Luciferase Stable Cell Line
TU107742 1.0 mL

Gm16430 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details