Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Camelpox virus A27L membrane protein (A27L)

This Recombinant Camelpox virus A27L membrane protein (A27L) spans the amino acid sequence from region 1-110aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

C9E791

Expression Region

1-110aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Camelpox virus (GUP)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIIKADGDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMDM (with PS)
MBS2567565-01 500 mL

IMDM (with PS)

Sign In for Pricing
View Details
IMDM (with PS)
MBS2567565-02 5x 500 mL

IMDM (with PS)

Sign In for Pricing
View Details
Tas2r38 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6293808 1.0 µg DNA

Tas2r38 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
AffiniPure Donkey Anti-goat IgG (H+L) secondary antibody, Biotin Conjugated
BA1018-0.5ml-01 0.5 mL

AffiniPure Donkey Anti-goat IgG (H+L) secondary antibody, Biotin Conjugated

Sign In for Pricing
View Details
AffiniPure Donkey Anti-goat IgG (H+L) secondary antibody, Biotin Conjugated
BA1018-0.5ml-02 1 mL

AffiniPure Donkey Anti-goat IgG (H+L) secondary antibody, Biotin Conjugated

Sign In for Pricing
View Details
Fmoc-Asp(OtBu)-SASRIN resin (200-400 mesh, 0.4-0.7 mmol/g)
D-1315.0001 1.0g

Fmoc-Asp(OtBu)-SASRIN resin (200-400 mesh, 0.4-0.7 mmol/g)

Sign In for Pricing
View Details