Recombinant Cowpox virus 14 kDa protein (A27L)
This Recombinant Cowpox virus 14 kDa protein (A27L) spans the amino acid sequence from region 1-110aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
14 kDa protein;14K membrane protein;14kDa fusion protein ; CPXV162 protein ; IMV membrane protein
UniProt
Q66272
Expression Region
1-110aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Cowpox virus (CPV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKAEGDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx518214 96 Tests
Cow Pyridoxal phosphate phosphatase (PDXP) ELISA Kit
Sign In for Pricing
View Details 
MR219912L4 10 µg
Defb25 (NM_001039122) Mouse Tagged Lenti ORF Clone
Sign In for Pricing
View Details RR204208L3V 200 µL
Wdr61 (NM_001025743) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details