Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)
This Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active) spans the amino acid sequence from region 31-157aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
UniProt
Q7Z6A9
Expression Region
31-157aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2 μg/mL can bind Anti-BTLA recombinant antibody. The EC50 is 11.56-13.00 ng/mL.
Form
Lyophilized powder
Molecular Weight
16.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D965680-50MG 50 mg
4"-Desmorpholino,-4"-morpholin-3-on-4-yl Momelotinib Carboxamide
Sign In for Pricing
View Details 
PKSH030806 50 µg
Recombinant Human CD93/C1QR1 Protein (aa 1-580, His Tag)
Sign In for Pricing
View Details 
![eIF4EBP1 Recombinant Rabbit Monoclonal Antibody [JJ09-25]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea825d0/imageurl/et1701-83.webp)
ET1701-83 100 µL
eIF4EBP1 Recombinant Rabbit Monoclonal Antibody [JJ09-25]
Sign In for Pricing
View Details 
BNC402227-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details