Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active)

This Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active) spans the amino acid sequence from region 26-232aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL4RA;582J2.1

UniProt

P24394

Expression Region

26-232aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human IL4 at 2 μg/mL can bind biotinylated Human IL4R. The EC50 is 12.68-14.23 ng/mL.

Form

Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)
MBS1361980-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)
MBS1361980-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)
MBS1361980-03 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)
MBS1361980-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)
MBS1361980-05 0.02 mg (Baculovirus)

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)
MBS1361980-06 1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Class II metallothionein-like protein 1A (MT21A)

Sign In for Pricing
View Details