Recombinant Lactococcus lactis subsp. lactis Lipoprotein signal peptidase (lspA) (I65V)
This Recombinant Lactococcus lactis subsp. lactis Lipoprotein signal peptidase (lspA) (I65V) spans the amino acid sequence from region 1-150aa (I65V) . Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Prolipoprotein signal peptidase Signal peptidase II
UniProt
Q9CGU5
Expression Region
1-150aa (I65V)
Tag
C-terminal 6xHis-tagged
Source
In vitro E.coli expression system
Origin
Lactococcus lactis
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EKN52168 96 Tests
Mouse Macrophage Inflammatory Protein 1 Gamma (MIP1g) ELISA Kit
Sign In for Pricing
View Details 
BNCB0198-100 1x 100 µL
Cytokeratin 18 (DA7), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details