Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active)
This Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active) spans the amino acid sequence from region 26-138aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
UniProt
A0A2K5VD75
Expression Region
26-138aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Gastroenterology & Hepatology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody. The EC50 is 12.66-13.86 ng/mL.
Form
Lyophilized powder
Molecular Weight
14.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
AA Sequence
GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740029-500 1x 500 µL
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details