Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CAAX prenyl protease 2 (RCE1)

This Recombinant Human CAAX prenyl protease 2 (RCE1) spans the amino acid sequence from region 1-329aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Farnesylated proteins-converting enzyme 2 (FACE-2) ; Prenyl protein-specific endoprotease 2; RCE1 homolog (hRCE1)

UniProt

Q9Y256

Expression Region

1-329aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Serotonin,5-HT ELISA KIT
E0252FI-01 48 Well

Fish Serotonin,5-HT ELISA KIT

Sign In for Pricing
View Details
Fish Serotonin,5-HT ELISA KIT
E0252FI-02 96 Well

Fish Serotonin,5-HT ELISA KIT

Sign In for Pricing
View Details
Fish Serotonin,5-HT ELISA KIT
E0252FI-03 5x 96 Tests

Fish Serotonin,5-HT ELISA KIT

Sign In for Pricing
View Details
Fish Serotonin,5-HT ELISA KIT
E0252FI-04 10x 96 Tests

Fish Serotonin,5-HT ELISA KIT

Sign In for Pricing
View Details
Phosphatidylinositol Glycan Anchor Biosynthesis Class Z (PIGZ) Antibody
abx236447 100 µg

Phosphatidylinositol Glycan Anchor Biosynthesis Class Z (PIGZ) Antibody

Sign In for Pricing
View Details
Recombinant Alcanivorax borkumensis Elongation factor G (fusA), partial
MBS1472480 Inquire

Recombinant Alcanivorax borkumensis Elongation factor G (fusA), partial

Sign In for Pricing
View Details