Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1)

This Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1) spans the amino acid sequence from region 1-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G-protein coupled receptor GPCR19; hGPCR19; Membrane-type receptor for bile acids; M-BAR; hBG37; BG37

UniProt

Q8TDU6

Expression Region

1-330aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELA2A (NM_033440) Human Tagged ORF Clone
RC202746 10 µg

CELA2A (NM_033440) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Organic Solute Carrier Partner 1 (OSCP1) ELISA Kit
DLR-OSCP1-Hu-96T 96 Tests

Human Organic Solute Carrier Partner 1 (OSCP1) ELISA Kit

Sign In for Pricing
View Details
CSNK1G1 Protein Lysate
OCOA08703-20UG 20 µg

CSNK1G1 Protein Lysate

Sign In for Pricing
View Details
Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)
MBS143282-01 0.005 mg

Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)

Sign In for Pricing
View Details
Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)
MBS143282-02 0.02 mg

Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)

Sign In for Pricing
View Details
Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)
MBS143282-03 1 mg

Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)

Sign In for Pricing
View Details