Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin (SYP)

This Recombinant Human Synaptophysin (SYP) spans the amino acid sequence from region 1-313aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major synaptic vesicle protein p38

UniProt

P08247

Expression Region

1-313aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A*11:01&B2M&KRAS G12D (VVVGADGVGK) Tetramer, His & Avi, Human
Z06618-100 100 µg

HLA-A*11:01&B2M&KRAS G12D (VVVGADGVGK) Tetramer, His & Avi, Human

Sign In for Pricing
View Details
Mrgprx2l (NM_001002285) Rat Tagged ORF Clone Lentiviral Particle
RR200623L3V 200 µL

Mrgprx2l (NM_001002285) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Interleukin 13 (IL-13) ELISA Kit
JL16983-01 48 Tests

Rabbit Interleukin 13 (IL-13) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 13 (IL-13) ELISA Kit
JL16983-02 96 Tests

Rabbit Interleukin 13 (IL-13) ELISA Kit

Sign In for Pricing
View Details
LACE1 Antibody; FITC conjugated
MBS7000556-01 0.05 mg

LACE1 Antibody; FITC conjugated

Sign In for Pricing
View Details
LACE1 Antibody; FITC conjugated
MBS7000556-02 0.1 mg

LACE1 Antibody; FITC conjugated

Sign In for Pricing
View Details