Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

This Recombinant Human T-cell surface glycoprotein CD3 gamma chain (CD3G), partial spans the amino acid sequence from region 23-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor T3 gamma chain; CD antigen CD3g

UniProt

P09693

Expression Region

23-116aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuromedin B (NMB) (NM_021077) Human Over-expression Lysate
LC402828 20 µg

Neuromedin B (NMB) (NM_021077) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTH (POMC) Rabbit Polyclonal Antibody
TA363964 50 µL

ACTH (POMC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IL2Ra/CD25 Protein (His Tag)
PKSH033624-01 10 µg

Recombinant Human IL2Ra/CD25 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL2Ra/CD25 Protein (His Tag)
PKSH033624-02 50 µg

Recombinant Human IL2Ra/CD25 Protein (His Tag)

Sign In for Pricing
View Details
NBPF10 Human Gene Knockout Kit (CRISPR)
KN424355 1 Kit

NBPF10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NHLRC2 Human Gene Knockout Kit (CRISPR)
KN416229 1 Kit

NHLRC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details