Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

This Recombinant Human T-cell surface glycoprotein CD3 gamma chain (CD3G), partial spans the amino acid sequence from region 23-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor T3 gamma chain; CD antigen CD3g

UniProt

P09693

Expression Region

23-116aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Oxo-2H-pyran-6-carboxylic acid
AAA67267-01 100 mg

2-Oxo-2H-pyran-6-carboxylic acid

Sign In for Pricing
View Details
2-Oxo-2H-pyran-6-carboxylic acid
AAA67267-02 1 g

2-Oxo-2H-pyran-6-carboxylic acid

Sign In for Pricing
View Details
SENP1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61916R-PE-Cy7-TR 20 µL

SENP1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
IDH1 Mouse Monoclonal Antibody (Cy3)
orb2607434 100 µg

IDH1 Mouse Monoclonal Antibody (Cy3)

Sign In for Pricing
View Details
ZHX3 Double Nickase Plasmid (m2)
sc-435824-NIC-2 20 µg

ZHX3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
VEGFC Rabbit Polyclonal Antibody
53376-01 50 µL

VEGFC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details