Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial

This Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial spans the amino acid sequence from region 236-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTL-II

UniProt

Q9UIR0

Expression Region

236-355aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEPES Buffer 1M, pH 8.0
40820042-3 500 mL

HEPES Buffer 1M, pH 8.0

Sign In for Pricing
View Details
Pnp Antibody
orb824472 2 mg

Pnp Antibody

Sign In for Pricing
View Details
SDF1 (CXCL12) (NM_001033886) Human Tagged ORF Clone
RC223855 10 µg

SDF1 (CXCL12) (NM_001033886) Human Tagged ORF Clone

Sign In for Pricing
View Details
S15A3 rabbit pAb
E44H12662 100 µL

S15A3 rabbit pAb

Sign In for Pricing
View Details
ANKRD20A3 Double Nickase Plasmid (h)
sc-417277-NIC 20 µg

ANKRD20A3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Mepe sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7118406 1.0 µg DNA

Mepe sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details