Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A, R130A)

This Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A, R130A) spans the amino acid sequence from region 29-159aa (R127A, R130A) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q969D9

Expression Region

29-159aa (R127A, R130A)

Tag

C-terminal mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D2 (CCND2/2620), Biotin conjugate, 0.1mg/mL
BNCB2620-500 1x 500 µL

Cyclin D2 (CCND2/2620), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CA5A Antibody (Biotin)
KB-1333-01 50 μL

CA5A Antibody (Biotin)

Sign In for Pricing
View Details
CA5A Antibody (Biotin)
KB-1333-02 100 µL

CA5A Antibody (Biotin)

Sign In for Pricing
View Details
CA5A Antibody (Biotin)
KB-1333-03 1 mL

CA5A Antibody (Biotin)

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF740 conjugate, 0.1mg/mL
BNC740784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTLL1 Human Gene Knockout Kit (CRISPR)
KN421619 1 Kit

TTLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details