Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial, Biotinylated

This Recombinant Human CD276 antigen (CD276), partial, Biotinylated spans the amino acid sequence from region 29-245aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4Ig-B7-H3; B7 homolog 3; B7-H3; Costimulatory molecule; CD antigen CD276

UniProt

Q5ZPR3

Expression Region

29-245aa

Tag

C-terminal hFc1-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGRP II (Human) - EIA Kit
EK-015-07 96 Well

CGRP II (Human) - EIA Kit

Sign In for Pricing
View Details
Human LY6G6C knockout cell line
ABC-KH8801 1 Vial

Human LY6G6C knockout cell line

Sign In for Pricing
View Details
TP53INP1, NT (TP53INP1, P53DINP1, SIP, Tumor protein p53-inducible nuclear protein 1, Stress-induced protein, p53-dependent damage-inducible nuclear protein 1) (MaxLight 405) discontinued
043146-ML405 100 µL

TP53INP1, NT (TP53INP1, P53DINP1, SIP, Tumor protein p53-inducible nuclear protein 1, Stress-induced protein, p53-dependent damage-inducible nuclear protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Biotinylated Anti-CD38 (daratumumab biosimilar) mAb
12-9064B-100 100 µg

Biotinylated Anti-CD38 (daratumumab biosimilar) mAb

Sign In for Pricing
View Details
RMDN3 Antibody
OACA06833-100UL 100 µL

RMDN3 Antibody

Sign In for Pricing
View Details
Leucine-Rich Repeat-Containing Protein 40 Polyclonal Conjugated Antibody
MBS9451076-01 0.1 mL (Biotin)

Leucine-Rich Repeat-Containing Protein 40 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details