Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6), Biotinylated

This Recombinant Human Interleukin-6 (IL6), Biotinylated spans the amino acid sequence from region 30-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-6; B-cell stimulatory factor 2; BSF-2; CTL differentiation factor; CDF; Hybridoma growth factor; Interferon beta-2; IFN-beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

N-terminal Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3ar1 Mouse Gene Knockout Kit (CRISPR)
KN302378LP 1 Kit

C3ar1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tylvalosin-d9
TRC-T898212-2.5MG 2.5 mg

Tylvalosin-d9

Sign In for Pricing
View Details
neurobeachin like 1 (NBEAL1) Human Gene Knockout Kit (CRISPR)
KN426956 1 Kit

neurobeachin like 1 (NBEAL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stromal interaction molecuLe 1 (STIM1) (NM_003156) Human Recombinant Protein
TP305678L 1 mg

Stromal interaction molecuLe 1 (STIM1) (NM_003156) Human Recombinant Protein

Sign In for Pricing
View Details
3,5-Di-tert-butyl-4-hydroxycinnamic Acid
TRC-D679250-500MG 500 mg

3,5-Di-tert-butyl-4-hydroxycinnamic Acid

Sign In for Pricing
View Details
SHCBP1 (NM_024745) Human Recombinant Protein
TP305527 20 µg

SHCBP1 (NM_024745) Human Recombinant Protein

Sign In for Pricing
View Details