Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15), Biotinylated

This Recombinant Human Interleukin-15 (IL15), Biotinylated spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-15

UniProt

P40933

Expression Region

49-162aa

Tag

C-terminal hFc1-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: sigmoid
CS804867 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI2D8]
CF808899 100 µg

SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Usp46 Mouse Gene Knockout Kit (CRISPR)
KN518804 1 Kit

Usp46 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB600790 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
ZAP70 (2F3.2), 1mg/mL
BNUM0811-50 1x 50 µL

ZAP70 (2F3.2), 1mg/mL

Sign In for Pricing
View Details
RAD54 (RAD54L) (NM_003579) Human Recombinant Protein
TP320046M 100 µg

RAD54 (RAD54L) (NM_003579) Human Recombinant Protein

Sign In for Pricing
View Details