What sizes are available for Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs?

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs come in?

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs is available in 3 different pack sizes.

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs

Q: What is the catalog number for Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs?

The catalog number for Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs is orb1881814.

This Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs spans the amino acid sequence from region 1-291aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20

UniProt

P19437

Expression Region

1-291aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP