Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs
This Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs spans the amino acid sequence from region 1-291aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
UniProt
P19437
Expression Region
1-291aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
33.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DLR-ADORA2b-Hu-48T 48 Tests
Human Adenosine A2b Receptor (ADORA2b) ELISA Kit
Sign In for Pricing
View Details 
TL712996V 500 µL Each
Cxcl10 Rat shRNA Lentiviral Particle (Locus ID 245920)
Sign In for Pricing
View Details 