Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Frizzled-2 (FZD2), partial

This Recombinant Human Frizzled-2 (FZD2), partial spans the amino acid sequence from region 24-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fz-2; hFz2; FzE2

UniProt

Q14332

Expression Region

24-190aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MLKL [p Ser454] Antibody
NBP3-16934-20ul 20 µL

Rabbit Polyclonal MLKL [p Ser454] Antibody

Sign In for Pricing
View Details
OGFR rabbit pAb Antibody
orb767462-01 50 μL

OGFR rabbit pAb Antibody

Sign In for Pricing
View Details
OGFR rabbit pAb Antibody
orb767462-02 100 µL

OGFR rabbit pAb Antibody

Sign In for Pricing
View Details
ELISA Kit For Lumican
E1496b 96 Tests

ELISA Kit For Lumican

Sign In for Pricing
View Details
Cytohesin-1 (m) : 293T Lysate
sc-125210 100 µg - 200 µL

Cytohesin-1 (m) : 293T Lysate

Sign In for Pricing
View Details
BMF Protein Vector (Human) (pPB-His-GST)
PV327051 500 ng

BMF Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details