Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial (Active)
This Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial spans the amino acid sequence from region 25-519aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mast/stem cell growth factor receptor Kit; EC:2.7.10.1; SCFR; Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD117; Kit; Sl
UniProt
P05532
Expression Region
25-519aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/mL can bind Mouse Kit. The EC50 is 15.57-20.95 ng/mL.
Form
Lyophilized powder
Molecular Weight
84.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal PANK3 Antibody (OTI3C4) [DyLight 755]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-73244IR 0.1 mL
Mouse Monoclonal PANK3 Antibody (OTI3C4) [DyLight 755]
Sign In for Pricing
View Details 
RC224189L2 10 µg
Histone H1.5 (HIST1H1B) (NM_005322) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
RDR-LIPC-Mu-48Tests 48 Tests
Mouse Lipase, Hepatic (LIPC) ELISA Kit
Sign In for Pricing
View Details 
abx337800-01 20 µg
U2 Small Nuclear RNA Auxiliary Factor 2 (U2AF2) Antibody (FITC)
Sign In for Pricing
View Details abx337800-02 50 µg
U2 Small Nuclear RNA Auxiliary Factor 2 (U2AF2) Antibody (FITC)
Sign In for Pricing
View Details