Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Chymotrypsin-like elastase family member 2A (CELA2A)

This Recombinant Bovine Chymotrypsin-like elastase family member 2A (CELA2A) spans the amino acid sequence from region 29-269aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Elastase II; Elastase-2; Elastase-2A

UniProt

Q29461

Expression Region

29-269aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVGGEDARPNSWPWQVSLQYSSSGQWRHTCGGSLIEQNWVLTAAHCISSSRTYRVVVGRQSLSTVESGSLTIAVSKSVIHEKWNSNQLAQGNDIALLKLASSVPLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQSNGALPDILQQGKLLVVDYATCSNPSWWGSTVKTNMICAGGDGVTSSCNGDSGGPLNCQAANRQWQVHGIVSFGSSLGCNYYRKPSVFTRVSNYNDWISSVIENN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCRLA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0771208 1.0 µg DNA

FCRLA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse GTPase KRas (KRAS) ELISA Kit
abx541437-01 96 Tests

Mouse GTPase KRas (KRAS) ELISA Kit

Sign In for Pricing
View Details
Mouse GTPase KRas (KRAS) ELISA Kit
abx541437-02 5x 96 Tests

Mouse GTPase KRas (KRAS) ELISA Kit

Sign In for Pricing
View Details
Mouse GTPase KRas (KRAS) ELISA Kit
abx541437-03 10x 96 Tests

Mouse GTPase KRas (KRAS) ELISA Kit

Sign In for Pricing
View Details
Recombinant protein HFABP (human)
MBS186259-01 1 mg

Recombinant protein HFABP (human)

Sign In for Pricing
View Details
Recombinant protein HFABP (human)
MBS186259-02 2x 1 mg

Recombinant protein HFABP (human)

Sign In for Pricing
View Details