Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Chymotrypsin-like elastase family member 2A (CELA2A)

This Recombinant Bovine Chymotrypsin-like elastase family member 2A (CELA2A) spans the amino acid sequence from region 29-269aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Elastase II; Elastase-2; Elastase-2A

UniProt

Q29461

Expression Region

29-269aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVGGEDARPNSWPWQVSLQYSSSGQWRHTCGGSLIEQNWVLTAAHCISSSRTYRVVVGRQSLSTVESGSLTIAVSKSVIHEKWNSNQLAQGNDIALLKLASSVPLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQSNGALPDILQQGKLLVVDYATCSNPSWWGSTVKTNMICAGGDGVTSSCNGDSGGPLNCQAANRQWQVHGIVSFGSSLGCNYYRKPSVFTRVSNYNDWISSVIENN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SOX17 activation kit by CRISPRa
GA112037 1 Kit

Human SOX17 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS802966 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715661 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB515276 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
ASAH3 (ACER1) Rabbit Polyclonal Antibody
TA368056 100 µL

ASAH3 (ACER1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CADM3 Antibody
KC-26898-01 50 μL

CADM3 Antibody

Sign In for Pricing
View Details