Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Cell death activator CIDE-B (CIDEB), partial

This Recombinant Bovine Cell death activator CIDE-B (CIDEB), partial spans the amino acid sequence from region 1-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell death-inducing DFFA-like effector B

UniProt

Q3T191

Expression Region

1-177aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEYLSNLDPSSLLRSVSNMSADLGRKVWTSAPPRQRPFRVCDNKRTTRKGLTAATRQELLDKALEALVLSGALTLVLEEDGTTVESEEFFQLLEDDTCLMVLELGQSWSPRRSGVLSYGLGQEKPKHSKDIARITFDVYKQSPRDLFGSLNIKATFYGLYSLSCDIQGLGPKKILRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DPF2 Recombinant Protein (N-His)
HP360022-01 50 µg

Human DPF2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human DPF2 Recombinant Protein (N-His)
HP360022-02 100 µg

Human DPF2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human DPF2 Recombinant Protein (N-His)
HP360022-03 1 mg

Human DPF2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Prostate Specific Antigen, Total (Total PSA) (PE) discontinued
P9054-13-PE 100 µL

Prostate Specific Antigen, Total (Total PSA) (PE) discontinued

Sign In for Pricing
View Details
Gel Clot TAL Assay 0.03EU/mL (Gel Clot Tachypleus Amebocyte Lysate Reagent)
NJF01030 10 Tests/Vial - 10 Vials/Kit

Gel Clot TAL Assay 0.03EU/mL (Gel Clot Tachypleus Amebocyte Lysate Reagent)

Sign In for Pricing
View Details
Fmoc-Orn (Boc) TentaGel® R TRT Resin
RA1220.25G 25 g

Fmoc-Orn (Boc) TentaGel® R TRT Resin

Sign In for Pricing
View Details