Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Multiple epidermal growth factor-like domains protein 6 (Megf6), partial

This Recombinant Mouse Multiple epidermal growth factor-like domains protein 6 (Megf6), partial spans the amino acid sequence from region 143-326aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3

UniProt

Q80V70

Expression Region

143-326aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFYCRCPPGYQLQGDGKTCQDVDECRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCLAISSCTLGNGGCQHQCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCADGNGGCMHTCQELRGLAHCGCHPGYQLAADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO1C Rabbit Polyclonal Antibody
JOT-AP11465-01 20 µL

MYO1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO1C Rabbit Polyclonal Antibody
JOT-AP11465-02 50 μL

MYO1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO1C Rabbit Polyclonal Antibody
JOT-AP11465-03 100 µL

MYO1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GSPT2 Protein Lysate (Human) with C-Ha Tag
22741031 100 µg

GSPT2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Tert-Butyl 4- (3-bromopropyl) piperazine-1-carboxylate oxalate
orb3176031-01 50 mg

Tert-Butyl 4- (3-bromopropyl) piperazine-1-carboxylate oxalate

Sign In for Pricing
View Details
Tert-Butyl 4- (3-bromopropyl) piperazine-1-carboxylate oxalate
orb3176031-02 10 mg

Tert-Butyl 4- (3-bromopropyl) piperazine-1-carboxylate oxalate

Sign In for Pricing
View Details