Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis Trigger factor (tig), partial

This Recombinant Ehrlichia chaffeensis Trigger factor (tig), partial spans the amino acid sequence from region 1-439aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TF; PPIase

UniProt

Q2GFT7

Expression Region

1-439aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLNSYVVREVSNDKLKWEYEFAVDKKYFLDQLDSKLSEIAMNVKVPGFRVGKASIDLVRKEYLNEAMTSVVKKTIESTSSDFVKNSKFGEIISSNIDIVSYPSYYSDNDKEEDLVYKLSFEVMPEAPLMDIDNIVLSDIEVDIQECDVNEFIENLKKQRPDFVIVDDPEYVIQGSDKLVIDYQNKIKGKILRGGSAKDFVLVLGKGVALREFEDQLIGMKVGESKTFPLTFPNDYGMVHLAGKTTDMSVTVKSVYVMKGMRDSEAIAKDYGFKDVGHMEDFARKRIKQQFDQMVFTIVKKELFDYMDANYVIDVPECVVTQEIAKINKEIRDSGEDIQIDVEKEAIKRVKLGMLLIKMSRHNNITIKNEDVFSFIQSNYADYGVDIGNVLKMLQSNKNFANYISGKVLEEKVINYIIGLAKKDKKVMTAKDISLMFENI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICAM3/CD50 (Rabbit, Monoclonal)
A114600 100 µL

Anti-ICAM3/CD50 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
SMOX (NM_175840) Human Tagged ORF Clone
RG200156 10 µg

SMOX (NM_175840) Human Tagged ORF Clone

Sign In for Pricing
View Details
NFXL1 Protein Vector (Mouse) (pPM-C-HA)
PV205320 500 ng

NFXL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
KChIP2 (KCNIP2) Human Over-expression Lysate
orb1353956 100 µg

KChIP2 (KCNIP2) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat major histocompatibility complexIII (MHCIII) ELISA Kit
YP-W38035-01 48 Tests

Rat major histocompatibility complexIII (MHCIII) ELISA Kit

Sign In for Pricing
View Details
Rat major histocompatibility complexIII (MHCIII) ELISA Kit
YP-W38035-02 96 Tests

Rat major histocompatibility complexIII (MHCIII) ELISA Kit

Sign In for Pricing
View Details