Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell division cycle and apoptosis regulator protein 1 (CCAR1), partial

This Recombinant Human Cell division cycle and apoptosis regulator protein 1 (CCAR1), partial spans the amino acid sequence from region 1-249aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell cycle and apoptosis regulatory protein 1; CARP-1; Death inducer with SAP domain

UniProt

Q8IX12

Expression Region

1-249aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQTQPQPQSLLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein FAM49B (FAM49B) ELISA Kit
MBS9940706-01 48 Well

Rat Protein FAM49B (FAM49B) ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM49B (FAM49B) ELISA Kit
MBS9940706-02 96 Well

Rat Protein FAM49B (FAM49B) ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM49B (FAM49B) ELISA Kit
MBS9940706-03 5x 96 Well

Rat Protein FAM49B (FAM49B) ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM49B (FAM49B) ELISA Kit
MBS9940706-04 10x 96 Well

Rat Protein FAM49B (FAM49B) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human GPR160 sgRNA gene knockout kit - Lentiviral human GPR160 sgRNA gene knockout kit (plasmid)
GTR15386108 1 Vial

Lentiviral human GPR160 sgRNA gene knockout kit - Lentiviral human GPR160 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
DNA-PKcs (E6U3A) Rabbit Monoclonal Antibody (Alexa Fluor® 488 Conjugate)
CST 75070S 100 µL

DNA-PKcs (E6U3A) Rabbit Monoclonal Antibody (Alexa Fluor® 488 Conjugate)

Sign In for Pricing
View Details