Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial

This Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial spans the amino acid sequence from region 723-871aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC

UniProt

Q9EPK8

Expression Region

723-871aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 Rabbit Polyclonal Antibody
AP14060PU-N 400 µL

GIT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL
BNC042879-100 1x 100 µL

Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Mtch1 activation kit by CRISPRa
GA205990 1 Kit

Mouse Mtch1 activation kit by CRISPRa

Sign In for Pricing
View Details
Bicyclo[2.2.1]hept-2-ene
TRC-B382870-25G 25 g

Bicyclo[2.2.1]hept-2-ene

Sign In for Pricing
View Details
Forget-Me-NotTM EvaGreen® qPCR Master Mix (100 reactions)
#31041-T 1x 1 mL

Forget-Me-NotTM EvaGreen® qPCR Master Mix (100 reactions)

Sign In for Pricing
View Details
Muc5ac (NM_010844) Mouse Recombinant Protein
TP522948 20 µg

Muc5ac (NM_010844) Mouse Recombinant Protein

Sign In for Pricing
View Details