Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-25 (MMP25)

This Recombinant Human Matrix metalloproteinase-25 (MMP25) spans the amino acid sequence from region 108-539aa. Purity: Purified by immunogen affinity chromatography

Product Specifications

Product Name Alternative

MMP-25; Leukolysin; Membrane-type matrix metalloproteinase 6; MT-MMP 6; MTMMP6; Membrane-type-6 matrix metalloproteinase; MT6-MMP; MT6MMP

UniProt

Q9NPA2

Expression Region

108-539aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Purified by immunogen affinity chromatography

Form

Liquid or Lyophilized powder

Molecular Weight

55.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Gilvum folE Protein (aa 1-202)
VAng-Yyj3899-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Gilvum folE Protein (aa 1-202)

Sign In for Pricing
View Details
Mouse Monoclonal HBsAg Antibody (1044/329)
NB100-64554-0.025mg 0.025 mg

Mouse Monoclonal HBsAg Antibody (1044/329)

Sign In for Pricing
View Details
Human SACM1L activation kit by CRISPRa
GA107903 1 Kit

Human SACM1L activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) YBIX Polyclonal Antibody
MBS7169203 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) YBIX Polyclonal Antibody

Sign In for Pricing
View Details
V450 Anti-Mouse CD3 (17A2)
MBS7620743-01 50 Tests

V450 Anti-Mouse CD3 (17A2)

Sign In for Pricing
View Details
V450 Anti-Mouse CD3 (17A2)
MBS7620743-02 100 Tests

V450 Anti-Mouse CD3 (17A2)

Sign In for Pricing
View Details