Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial, Biotinylated

This Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial, Biotinylated spans the amino acid sequence from region 306-351aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; CD antigen CD88

UniProt

P30993

Expression Region

306-351aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CWC15 sgRNA CRISPR Lentivector (Human) (Target 3)
K0533704 1.0 µg DNA

CWC15 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
U2AF2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62036R-BF680-TR 20 µL

U2AF2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Mouse Polyclonal MCT1/SLC16A1 Antibody
H00006566-B01P 0.05 mg

Mouse Polyclonal MCT1/SLC16A1 Antibody

Sign In for Pricing
View Details
DEAC-dUTP *1 mM in TE Buffer (pH 7.5) *
17034-AAT 100 nmoles

DEAC-dUTP *1 mM in TE Buffer (pH 7.5) *

Sign In for Pricing
View Details
Folic Acid (Vitamin B9, Pteroylglutamic acid) (MaxLight 550) discontinued
F5800-10A-ML550 100 µL

Folic Acid (Vitamin B9, Pteroylglutamic acid) (MaxLight 550) discontinued

Sign In for Pricing
View Details
γPAK (H-4)
sc-377194 200 µg/mL

γPAK (H-4)

Sign In for Pricing
View Details