Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Rat

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF-2 Protein, Rat, consists of 145 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF-2 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-rat.html

Purity

98.0

Smiles

ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

54250 (Gene_ID) P13109 (A11-S154) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Westermann R, et al. Basic fibroblast growth factor (bFGF), a multifunctional growth factor for neuroectodermal cells. J Cell Sci Suppl. 1990;13:97-117.|[2]Rusnati M, et al. Interaction of angiogenic basic fibroblast growth factor with endothelial cell heparan sulfate proteoglycans. Biological implications in neovascularization. Int J Clin Lab Res. 1996;26 (1) :15-23.|[3]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[4]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dibutylamine-d4
TRC-D462739-1MG 1 mg

Dibutylamine-d4

Sign In for Pricing
View Details
Elastopar
TRC-E324550-50MG 50 mg

Elastopar

Sign In for Pricing
View Details
MATER Rabbit Polyclonal Antibody
ER50101 100 µL

MATER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-II-,  15nm
GP-2002-15 1 mL

Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-II-, 15nm

Sign In for Pricing
View Details
CD86 (C86/1146), CF740 conjugate, 0.1mg/mL
BNC741146-100 1x 100 µL

CD86 (C86/1146), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNPC3 Human Gene Knockout Kit (CRISPR)
KN402319 1 Kit

RNPC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details