Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Rat

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF-2 Protein, Rat, consists of 145 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF-2 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-rat.html

Purity

98.0

Smiles

ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

54250 (Gene_ID) P13109 (A11-S154) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Westermann R, et al. Basic fibroblast growth factor (bFGF), a multifunctional growth factor for neuroectodermal cells. J Cell Sci Suppl. 1990;13:97-117.|[2]Rusnati M, et al. Interaction of angiogenic basic fibroblast growth factor with endothelial cell heparan sulfate proteoglycans. Biological implications in neovascularization. Int J Clin Lab Res. 1996;26 (1) :15-23.|[3]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[4]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (C68/684), CF594 conjugate, 0.1mg/mL
BNC940684-500 1x 500 µL

CD68 (C68/684), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pyraclostrobin-d6
TRC-P840402-1MG 1 mg

Pyraclostrobin-d6

Sign In for Pricing
View Details
BAT3 (BAG6) (NM_001098534) Human Recombinant Protein
TP319255L 1 mg

BAT3 (BAG6) (NM_001098534) Human Recombinant Protein

Sign In for Pricing
View Details
NDUFA6 (NM_002490) Human Over-expression Lysate
LC419290 20 µg

NDUFA6 (NM_002490) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF208 Human Gene Knockout Kit (CRISPR)
KN420711 1 Kit

ZNF208 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS801815 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details