Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Decapping and exoribonuclease protein (DXO)

This Recombinant Human Decapping and exoribonuclease protein (DXO) spans the amino acid sequence from region 1-396aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DXO;5'-3' exoribonuclease DXO; Dom-3 homolog Z; NAD-capped RNA hydrolase DXO; DeNADding enzyme DXO

UniProt

O77932

Expression Region

1-396aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVCA1 (DPH1) Human Gene Knockout Kit (CRISPR)
KN421955 1 Kit

OVCA1 (DPH1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAPI
#40011 1x 10 mg

DAPI

Sign In for Pricing
View Details
FAM20C (C-term) Rabbit Polyclonal Antibody
AP51278PU-N 400 µL

FAM20C (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Lgals12 activation kit by CRISPRa
GA205826 1 Kit

Mouse Lgals12 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Mouse MIP-1β (Macrophage Inflammatory Protein 1 Beta) ELISA Kit
E-UNEL-M0132-01 5x 96 Tests

Uncoated Mouse MIP-1β (Macrophage Inflammatory Protein 1 Beta) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse MIP-1β (Macrophage Inflammatory Protein 1 Beta) ELISA Kit
E-UNEL-M0132-02 15x 96 Tests

Uncoated Mouse MIP-1β (Macrophage Inflammatory Protein 1 Beta) ELISA Kit

Sign In for Pricing
View Details