Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Axin-2 (AXIN2), partial

This Recombinant Human Axin-2 (AXIN2), partial spans the amino acid sequence from region 745-843aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Axin-like protein; Axil; Axis inhibition protein 2; Conductin

UniProt

Q9Y2T1

Expression Region

745-843aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus Influenzae ureA Protein (aa 1-100) (strain PittEE)
VAng-Lsx03938-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae ureA Protein (aa 1-100) (strain PittEE)

Sign In for Pricing
View Details
Rabbit anti-NOP56 Antibody
MBS4505070-01 0.05 mL

Rabbit anti-NOP56 Antibody

Sign In for Pricing
View Details
Rabbit anti-NOP56 Antibody
MBS4505070-02 0.1 mL

Rabbit anti-NOP56 Antibody

Sign In for Pricing
View Details
Rabbit anti-NOP56 Antibody
MBS4505070-03 5x 0.1 mL

Rabbit anti-NOP56 Antibody

Sign In for Pricing
View Details
Anti-PSAP Antibody Picoband®, Dylight550 Conjugate
A00937-1-Dylight550 100 µg

Anti-PSAP Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Tifa Rat shRNA Lentiviral Particle (Locus ID 310877)
TL702176V 500 µL Each

Tifa Rat shRNA Lentiviral Particle (Locus ID 310877)

Sign In for Pricing
View Details