Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83)

This Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83) spans the amino acid sequence from region 1-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P52460

Expression Region

1-97aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAIGFICSSPDAELFSEKSRMSSSVLLGCLLCCMDWSAAVPGKTEPFRKLFDAIMIKKLKSCSAAYPSDLDEGSMCDMADASPTSLELGLSKLDKES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POM121 Human shRNA Lentiviral Particle (Locus ID 9883)
TL316887V 500 µL Each

POM121 Human shRNA Lentiviral Particle (Locus ID 9883)

Sign In for Pricing
View Details
BC032203 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
13131124 3x 1.0µg DNA

BC032203 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Thymidylate Synthase Antibody (rTYMS/1884) [Biotin]
NBP3-08887B 100 µL

Mouse Monoclonal Thymidylate Synthase Antibody (rTYMS/1884) [Biotin]

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) ELISA Kit
CK-bio-10611-01 48 Tests

Human Biliverdin Reductase B (BLVRB) ELISA Kit

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) ELISA Kit
CK-bio-10611-02 96 Tests

Human Biliverdin Reductase B (BLVRB) ELISA Kit

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) ELISA Kit
CK-bio-10611-03 5x 96 Tests

Human Biliverdin Reductase B (BLVRB) ELISA Kit

Sign In for Pricing
View Details