Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase RNF128 (RNF128), partial

This Recombinant Human E3 ubiquitin-protein ligase RNF128 (RNF128), partial spans the amino acid sequence from region 75-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gene related to anergy in lymphocytes protein; GRAIL; RING finger protein 128; RING-type E3 ubiquitin transferase RNF128

UniProt

Q8TEB7

Expression Region

75-183aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1311343 Protein Vector (Rat) (pPM-C-His)
PV299933 500 ng

RGD1311343 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human WD repeat-containing protein 46, WDR46 ELISA KIT
ELI-28742h 96 Tests

Human WD repeat-containing protein 46, WDR46 ELISA KIT

Sign In for Pricing
View Details
NUBP1 Antibody (Center) Blocking Peptide
MBS9223872-01 0.5 mg

NUBP1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
NUBP1 Antibody (Center) Blocking Peptide
MBS9223872-02 5x 0.5 mg

NUBP1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
GLRA1 Rabbit pAb
E45R25040N-50 50 µL

GLRA1 Rabbit pAb

Sign In for Pricing
View Details
Sheep Rhodopsin (RHO) ELISA Kit
MBS285774-01 48 Tests

Sheep Rhodopsin (RHO) ELISA Kit

Sign In for Pricing
View Details